DPCstruct | MC9377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349NNS7 | 2-111 | SVNTKAVTNANSLIENDKVDRESSWSFSAADGNALLGEDGDDWENYGKWFLMINPEANEETKAHYKFPFGKNDKLYRSALTAIRQRA… |
| A0A1F9GY98 | 21-131 | KTEKKNPDGIIHANSLIEAGKVKRTSFWEPPTADKENAYIEANGIKEYGKWFLGTDSTINANNKSYYTYAYTSDFEKVDSAGLIAVK… |
| A0A1E3EDG9 | 2-109 | None |
| A0A2D6XIA5 | 17-138 | None |
| A0A2V5RTC9 | 104-220 | None |
| A0A522EXF5 | 2-107 | None |
| A0A1H4NUS2 | 2-113 | None |
| A0A7C5VIZ4 | 2-109 | None |
| A0A0A1H6F9 | 3-109 | None |
| A0A1Q7TQE1 | 8-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.