DPCstruct | MC9376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 171 ± 34 aa |
| Standard deviation of domain lengths | 34.02 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 17.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7GYJ6 | 39-182 | SKFGRRIGTITSMSSILLVGDSIFNKECANGFDFSLVAPDQTVEEAESVIRSHALELVEVKTLLEEESWKEAQKELRRSSGRLRSDI… |
| A0A804I265 | 8-112 | GCVYRIRKCVFDLLSMEEDLIDDDEDTWELMGSSLRLKSTFLYCDLNQVISRAKDERKKFLTDLANKLFCYMEQLDHAVKSRSISLT… |
| D7FKF8 | 101-284 | None |
| A0A7S2UZ25 | 121-296 | None |
| A0A251WLQ0 | 1-152 | None |
| W7U1E9 | 2-219 | None |
| A0A5P1FAM7 | 2-131 | None |
| A0A0E0Q9J3 | 4-206 | None |
| A0A7S0L947 | 1-229 | None |
| B0C5R1 | 11-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.