DPCstruct | MC9372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 280 ± 63 aa |
| Standard deviation of domain lengths | 62.87 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0187- PF20249 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A558JD71 | 9-235 | ACEGEKLFIQVMGKDHPEGHEIVIVNQHSGEPLDDFGEAETEELSDPTSVLHKWCWQGLQRVDAQLHIATEAGEPIKLPLLKWLYKN… |
| A0A7C8M3K9 | 101-370 | FSSSAVCDSSDSLPPAEEPEYVSQEVAAATRTEPEKNYSYHLEIVCPSDKRTTYAPGTFNLAELRDEEASLVLAQDTSATDTVWLST… |
| A0A7X4LPG0 | 101-498 | None |
| A0A128ERG3 | 95-354 | None |
| A0A7X5AYV8 | 9-386 | None |
| A0A7X5BMJ9 | 11-219 | None |
| W8KJG6 | 310-584 | None |
| A0A1R4B100 | 74-464 | None |
| A0A2R7PE93 | 123-374 | None |
| K1JR46 | 94-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.