DPCstruct | MC9371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1786 |
|---|---|
| Mean domain length (aa) | 71 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 97.52 |
| Assigned Pfam label(s) | CL0023- PF01066- PF01077- CL0063- PF02662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8HYE3 | 11-86 | AMPKKNKGQTFVCVYPDWCKGCGLCVAFCPGKVLQLNALGKAEVVRPEECINCGFCELHCPDFAIAVRPNVSRNGV |
| A0A7J4TIS3 | 36-80 | ALCIGCGTCAMACQTRALSMTNGRPELNSDRCIKCGICYVQCPRS |
| A0A0U2MA48 | 6-67 | None |
| A0A0U3FZA3 | 176-247 | None |
| A0A1F6RCE8 | 2-64 | None |
| A0A1F6RCG0 | 280-357 | None |
| A0A7C5QFI3 | 11-75 | None |
| A0A7C1HT34 | 140-199 | None |
| A0A7Y2XJM0 | 4-68 | None |
| A0A1G3XVE4 | 258-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.