DPCstruct | MC9370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060X961 | 206-319 | EIEDSEAVGISNIISNLISTFPRVILTALPSELFTSFINCLTLLTCSFGRSAALEEVLDKDDMVYMEAYDKLLESWLTLVQDDEHFP… |
| A7SX42 | 20-132 | SHMNSQSALGLATIANRMVFVFSGNVLASLPPQLLHSTITTLTEITCSYMQAVAKEEELHSEDTSFMEAVEQILEAWGHLLDSIDKF… |
| S7MJB1 | 44-156 | None |
| A0A5B7ISX1 | 6-118 | None |
| A0A7R9CWP9 | 12-127 | None |
| A0A2K6GH83 | 320-432 | None |
| A0A6F9AZJ1 | 102-215 | None |
| A0A7R9B911 | 1-99 | None |
| A0A5E4DC35 | 226-344 | None |
| A0A7R9JVA6 | 321-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.