DPCstruct | MC9369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 151 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3CEL7 | 37-179 | SVSRFAYFMLFTLSIFLSWIFRDYAQGLMKKIPWIDHFGVRPSDEWFGKQAVYRLSFGNFMFFAAFSVLLVGVKYKGEARAKLHTGG… |
| A7SSC6 | 3-162 | TSTRIMYTVFLLLGTIVSCLMLWDQVEKSIVEHDPLGIFGKVCDEAGAGDKCELLAGHLAVYRVCFAMACFFFLFMIITIKVSSSKD… |
| A0A4Y7JPI8 | 5-179 | None |
| A0A7J8X2D3 | 1-174 | None |
| A0A091DTL2 | 178-332 | None |
| A0A3P6P5P9 | 2-139 | None |
| A0A3Q0IXE8 | 20-194 | None |
| A0A5P1F290 | 168-317 | None |
| A0A1D2NGW6 | 122-284 | None |
| A0A6S7G6X1 | 21-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.