DPCstruct | MC9368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 140 |
|---|---|
| Mean domain length (aa) | 253 ± 47 aa |
| Standard deviation of domain lengths | 47.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 99.48 |
| Assigned Pfam label(s) | CL0027- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R2MQ75 | 4-250 | ITKTDRVQCSRAAETNWVYVENGKYRISRKARQRHTKIHCFYVPILRGIDDYTVRLGSKTDFIDGDPLKFDFSEVHCTSPTTGENYT… |
| A7SRS5 | 163-375 | GGCKLPKLQKYYEEIMHLVERLPPITCDVNHLHTKLEHGVLQMRENATKDPQVTSLHARPIRRGKNDDTITYGPPWHFNLTAKSLQV… |
| A0A7M5UZE6 | 56-267 | None |
| A0A0D8XJL0 | 154-392 | None |
| A0A226F4X5 | 217-521 | None |
| A0A2W1BR59 | 91-341 | None |
| A0A6A4KJR4 | 351-746 | None |
| A0A820UHS3 | 55-236 | None |
| A0A7R9AST6 | 167-440 | None |
| A0A0M3INZ9 | 62-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.