DPCstruct | MC9365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 127 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4B7T4 | 544-667 | KEPKNKMRKMLKRKVEKSLSNADFDLCEPEICVSVLSIPSVKSLTALKKKITKGEKAWIQGFLDAKGLDALLDNVDTMSSRRVTNLS… |
| A7SLR5 | 1-125 | MAAKTKWSSLKRQLSGNDTNKSLSDDATPDLCIRLLRFPSVGNFSGLKTKLKKSSSEWMGEFLCLDGMSVLLSALERVGSRAARSSH… |
| A0A2T7PM18 | 113-234 | None |
| A0A2I0TCC3 | 47-166 | None |
| B7PR18 | 1-122 | None |
| A0A4Y2T8M0 | 13-151 | None |
| A0A212CRU0 | 10-128 | None |
| A0A2T7PM41 | 297-420 | None |
| A0A3Q2IAI8 | 153-297 | None |
| A0A484CFY9 | 6-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.