DPCstruct | MC9362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 115 ± 23 aa |
| Standard deviation of domain lengths | 22.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0J0V6 | 2-111 | SSGFISETEIANQRQRRQEEWEKVRTADQPVEAPEEEYDPRSLFDRLKEQKDKKEFEYEEAHKLKNMIKGLDDDEVEFLDLVDKSKF… |
| A7SI62 | 6-105 | GLKSFVSETEAEEIRKKRQEEWEKVRKPDDPIGKPEAEVDNRTLYEKLQEQKDKKQEEWEEQHKFKNLFRGIDGDEAEFLDLVSKQQ… |
| A0A669QR35 | 1-91 | None |
| A0A674AH14 | 4-83 | None |
| A0A0V0S3A8 | 3-126 | None |
| A0A673JEB3 | 13-93 | None |
| A0A060X8P8 | 48-176 | None |
| A0A5N5T2U0 | 1-137 | None |
| W2SGG5 | 1-122 | None |
| A0A183DPF6 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.