DPCstruct | MC9361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 47 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.60 |
| Pfam Score | 99.57 |
| Assigned Pfam label(s) | CL0016- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6WDU3 | 41-82 | NIDECLENTAYCHRDATCSDTEGFYACICKQGYTGDGLYCTD |
| A7SGF3 | 1-48 | DIDECKTGRSECHQNATCTNTVGSYRCICNEGFWGDGITCRRKWKSRI |
| T1GWQ7 | 233-275 | None |
| A0A7D9L4W4 | 186-233 | None |
| A0A6J0YHR8 | 26-68 | None |
| A0A6P3YCH9 | 556-599 | None |
| A0A643BUE5 | 16-63 | None |
| A0A3B5L0J9 | 1-53 | None |
| A0A1S3IU42 | 30-72 | None |
| A0A6N2D9P2 | 282-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.