DPCstruct | MC936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8M5M4 | 20-96 | RAEAIKAIPKSLKDENDNVILDKFTDKVNGKVAYKEPKTGWTIEKDTAGHGGRKWKLKNKSGDRVASLDENGKVLSK |
| A0A7T7P0S0 | 4-82 | NTHKVAKGINSSLLTSKGVDIGKFTQKVRGKNPVYRDPKTGWSISKNKGRPHGGSYWKLLDKGGTRKATLTKDGKILRK |
| A0A7X2NNQ6 | 138-210 | None |
| A0A0T9RTQ1 | 11-92 | None |
| A0A448UKI1 | 242-311 | None |
| A0A8B1CES8 | 2-67 | None |
| A0A518V4T0 | 160-238 | None |
| A0A377R0A7 | 212-284 | None |
| A0A075SGB7 | 31-127 | None |
| A0A840PVZ9 | 87-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.