DPCstruct | MC9359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 172 ± 33 aa |
| Standard deviation of domain lengths | 33.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7PFQ3 | 1-113 | MSQGMHLQDEEENMEVSEDFLEFLQQSEQHRVEWKIRKVKKALDEEKQSEESEKDSKPKEHPDVIRSREMHQLYGEAAARIHAMETA… |
| A7SEI1 | 21-191 | YQDYLYYGGSVYGCSSWCDDDYYGIFHDNSWQNQKNHGSVDEPRIQQRCQEQCEMDVIEDGTANSEDEGLQVDEAFRKFLEQSAKHR… |
| A0A6J8AWQ0 | 117-324 | None |
| A0A6J3IH23 | 115-343 | None |
| S4RRV5 | 2-143 | None |
| A0A7J8EJ61 | 15-159 | None |
| A0A821C438 | 1-128 | None |
| A0A2P8ZEU2 | 38-252 | None |
| E9IQK5 | 3-160 | None |
| B3S9P3 | 33-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.