DPCstruct | MC9354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 162 ± 15 aa |
| Standard deviation of domain lengths | 14.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.55 |
| Pfam Score | 87.64 |
| Assigned Pfam label(s) | CL0123- PF20239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9QDP3 | 10-162 | GLTTAQVARAFLVSEATLAQRIVRAKRKIVAAGIALEVPDAAALPARLSDVRTVIYACYNEAFVSTTGTQDRALGADAVWLAELVAA… |
| A0A527HPE6 | 2-149 | GLTVKQIARAFLVGESAMEQRITRAKARIADAGVPFETPGAVERSERLAAVAAMIYLIFNEGYSTNGGEAPARAPLCEEAIRLARLL… |
| A0A3E0HL35 | 117-278 | None |
| A0A535PTF5 | 1-199 | None |
| A0A511CVI6 | 16-148 | None |
| A0A2E4HCY0 | 36-210 | None |
| A0A2W7C1Q6 | 2-148 | None |
| A0A4Q5J4H1 | 105-275 | None |
| A0A0K2RC23 | 22-187 | None |
| A0A538N1R6 | 48-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.