DPCstruct | MC935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A560L5M1 | 51-126 | LVIVAVPSLSALLLNAEKLSGKPLTQSQVEAVRDSAAAIAVPTSAAEAVEERRGYKDVDFSHVWEEWQVLRRQFDQ |
| A0A7G6RYJ3 | 1-81 | MQLDDNLLIYPMPSLVATLLNAETSKGRPLIEEEVIFIRDNCPSIAVPREVALKIDEERGYKDIDLEKAWEEWQEARKLLV |
| A0A157SEI2 | 4-84 | None |
| A6DNV1 | 1-81 | None |
| A0A146HA49 | 211-291 | None |
| A0A7Y9FJS1 | 47-116 | None |
| A0A534U9M1 | 2-72 | None |
| A0A7V8V7D9 | 1-81 | None |
| M5STZ1 | 8-94 | None |
| A0A6P2D120 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.