DPCstruct | MC9349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 194 ± 44 aa |
| Standard deviation of domain lengths | 44.31 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF07670- PF07664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2B8U0 | 21-221 | MPIYQKPKLKTAWKQMYRQSKVFLKKAGTTIFALSVIIWCLSSFPRIDPNNYPNKTETEIASIQLEKSAIGTLGQVIEPVIRPLGYD… |
| A0A7X7ZVT3 | 2-137 | IWLMANVSVNGISLLDHCAGFLDPFARLIGLDGYILMAFILGLPANEIVIPIILMSYMSAGTMLEPQSLDDLRLLLVNNGWTWVTAV… |
| A0A3C0WNB5 | 426-607 | None |
| A0A350BAZ8 | 114-287 | None |
| A0A0U3NQK7 | 473-719 | None |
| A0A812NTX6 | 420-670 | None |
| W0DRH7 | 6-133 | None |
| A0A7C3XY40 | 140-311 | None |
| A0A848TRP5 | 121-328 | None |
| A0A133NXD1 | 81-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.