DPCstruct | MC9348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 140 ± 33 aa |
| Standard deviation of domain lengths | 32.71 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.77 |
| Pfam Score | 92.94 |
| Assigned Pfam label(s) | PF08755- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835WRM2 | 92-280 | ADYAAELLRLRTEMQRAVEAEDYASAAKFRDLLKELETEAKKAAALAAEWDTTSPSGPVLRLGQRVLHKQLGYRGVVVGWDMRCCES… |
| A0A671S2W7 | 16-133 | VRSPRPAYVLHRVGQVVMTQNNMVGVIVGWDAELRAPPEWIKRMKYSELERAKDTPHYRIMFSGPDSSSILIGYIPQYNIKLFQGFQ… |
| A0A1X7THN6 | 42-185 | None |
| W7UA55 | 81-237 | None |
| B4R9R0 | 75-186 | None |
| A0A7S2JM68 | 62-205 | None |
| A0A7S2N292 | 66-156 | None |
| A0A2R7RTF8 | 5-86 | None |
| H0ENB3 | 476-629 | None |
| A0A5B7DZ53 | 53-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.