DPCstruct | MC9346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 12.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8RJH2 | 3-95 | SVITDAELKKSVEALSEKFTEAMVHLEDARHSAGTVYFSEDAKEAEEIVQDTLNDFSELLSGLDAKQQLWVKRTIGLKMEELKAQLQ… |
| A0A835WMW5 | 16-118 | APLSGLWGGRWFASAPLDVAKEVDTVNELFAAARDEIEYAKEEAETVYFNESVGEAKKAVEACLGRWEALLAALPEEERARVVRSMG… |
| A0A7J6FQ02 | 472-581 | None |
| A0A1Y1Y346 | 3-140 | None |
| A0A2R6Q0X0 | 50-164 | None |
| A0A167NAH8 | 79-191 | None |
| A0A517KZJ5 | 4-137 | None |
| A0A7S0H380 | 32-142 | None |
| A0A498IXV1 | 897-1004 | None |
| A0A1Y1HPC2 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.