DPCstruct | MC9344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 172 ± 21 aa |
| Standard deviation of domain lengths | 21.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2V9B1 | 40-220 | IPVKFADHTPDSIKTEHVNIEYWGSGIIEGTVFDNLSMQVTPNNHDRALTAPQEGYFDHNTYKTLRIVSEKYEFMYTVWCNGEHELY… |
| A0A507B4U4 | 733-863 | TYKSLRLIGSGYNLYYSVWCTNEHELYNMVDDPYQMNNQLADFKAGTDMSQIKGNMMGHPLSKLVPRIDALQLVLKSCKGASCRDPW… |
| A0A835XSD4 | 649-823 | None |
| A0A261Y8A1 | 718-858 | None |
| A0A2J7ZLH3 | 215-395 | None |
| A0A0F4GUK4 | 830-1055 | None |
| A0A4S2MQR2 | 500-670 | None |
| A0A2J8ACW0 | 160-313 | None |
| A0A4Q4YAI7 | 681-872 | None |
| A0A7T7BNK5 | 172-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.