DPCstruct | MC9343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 391 ± 65 aa |
| Standard deviation of domain lengths | 64.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0001- PF03016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q10R19 | 7-472 | ICWLSYTGKRCEEVQKVECNLPSSQEWPVGRWIVSICPAHCDTTRAMCFCGPGTKYPDRPVAEACGFKTILPKKPDDSKLTDWKTPD… |
| A0A835WB79 | 1-402 | MAACRVSPDDPGSCSTLFTRNCECYRACHRLYCHDPAKADRCTHELGSNMAIARCWLRSGWQRGPTGPAGSELPEDWARGGTTWYKH… |
| A0A7N0T386 | 31-404 | None |
| A0A1Z5SB56 | 110-540 | None |
| A0A835YBQ3 | 102-396 | None |
| A0A835Y474 | 30-439 | None |
| A0A835XQ50 | 558-992 | None |
| A0A383V833 | 18-533 | None |
| D8TNG1 | 18-292 | None |
| A0A836BYD0 | 20-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.