DPCstruct | MC9342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 20.39 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 89.47 |
| Assigned Pfam label(s) | PF00696- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835W7V3 | 8-130 | TPAPLAAAATPAPAGVRRIIKLGGAAVTVKSQLETLRPEVLDSLVRTLSATAEPGAGAGGGTSASASTGASGTVLVHGAGSFGHFPA… |
| A0A6J8CZM0 | 3-98 | LDSIIKFGGSAVTVKDTLETLKEDELTHACCIVKNFLQNGKRIVIVHGAGSFGHHQAKRYNINAGFTNEDTKKGFCMTRVSVTKLNN… |
| A0A6G1DCK0 | 3-145 | None |
| A0A1F6EDW2 | 1-97 | None |
| A0A5A7V3I6 | 2-124 | None |
| A0A2B4SQ66 | 5-101 | None |
| F4Q8X6 | 10-106 | None |
| A0A811NXB8 | 1-148 | None |
| A0A7I4EDR3 | 27-153 | None |
| A0A7J6UJH1 | 34-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.