DPCstruct | MC9339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3Z6W6 | 8-105 | LAIAAIDPAPLFALSLVPYLLFIWWAQRRQLIPRLSLLGFQLTLLFVAVTIAAALVADQRFGAELVDVDGLHGGAEAFLTLSNAVIV… |
| A0A835SQL0 | 19-118 | VNAASLAPQLFAMSLFPYLCFLFYLTKSGKTPKLTLFGFYFLLAFVGATIPAGIYAKTVYGTSLANVDWLHGAAESLLTVTNLFVVL… |
| A0A068UUC2 | 73-169 | None |
| A0A078IBD1 | 122-235 | None |
| A0A7S3UAX7 | 74-182 | None |
| A0A5A7PC94 | 65-183 | None |
| A0A326QZX2 | 34-131 | None |
| I0ZB15 | 23-140 | None |
| A0A1R3K799 | 71-187 | None |
| A0A4R2RVF6 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.