DPCstruct | MC9337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | CL0101- PF11527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0A2M2 | 19-131 | LACRMEEWLMSTSFLMSLNTFAKRHAPMFEDVKGGEHPHAWFDAFREYETMVNDRVEAFLVSEGVSAEEAVAACRVAKAAGKTDYKF… |
| J9I7X7 | 418-558 | ADASADIKLQTFTEEQLQKDIELVGKLEDFCSSGEFTQLMQEFGENHCMSFEGTEEQNIECYQIYKEYCKLLDSKLDEFLLKEGIVA… |
| W4GAV6 | 11-166 | None |
| A0A7J6KXV3 | 34-210 | None |
| A0A1V9YAT2 | 174-330 | None |
| A0A7S2UYU1 | 26-179 | None |
| K3WXW5 | 8-130 | None |
| A0A0G4HZU2 | 7-137 | None |
| A0A0P1AZA0 | 4-136 | None |
| A0A7S2NII4 | 11-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.