DPCstruct | MC9332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9LL42 | 3-105 | LTLTLETLLSQLGSFSWHLDVYKALEQPLSPTMSVLIIDDELEEERDQQDEPLYPQTQGYQYFLSIADLQSIKANLVQQLPHATLHD… |
| E3EFT4 | 16-134 | RPSYRVFEGMQELVCSVGQLHNNWLYVNVDQWDQDPVHTPIYYLDEHWLEECAEDGTAATNEQDEYIPLWISDRQVQTWFELATFES… |
| A0A2N9NDU7 | 1-95 | None |
| A0A7X6SVL7 | 6-110 | None |
| A0A8B3JE21 | 104-222 | None |
| A0A6S6ZZU9 | 1-111 | None |
| A0A085HAX5 | 247-357 | None |
| A0A246FP01 | 6-105 | None |
| A0A1M6HUD9 | 17-123 | None |
| A0A7Z2QYI3 | 2-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.