DPCstruct | MC9330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9MZU0 | 210-268 | PGDVDGNGKVELADAVLALKIMAGITIPPEQTVKLGADVNGDGKIGMAEVVYILRTLAK |
| A0A1W9LLB4 | 86-149 | EAGMPGDVNDDGAAAGLADAILALKIVCAADLKEANISVAADTDGDKKIGIHEVLYILRKLAGL |
| A0A1V1X103 | 876-932 | None |
| A0A7C1DMJ1 | 74-138 | None |
| A0A661S445 | 1-76 | None |
| A0A3C1SCJ6 | 631-684 | None |
| A0A7C4SZI8 | 275-332 | None |
| A0A1W9LMJ2 | 194-253 | None |
| A0A1W9LUN6 | 434-486 | None |
| A0A662M5Y3 | 184-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.