DPCstruct | MC933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 158 ± 9 aa |
| Standard deviation of domain lengths | 8.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.73 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0010- PF09801 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QGX8 | 6-153 | RFFGADQFNPRLITTQIIVMQSSFWFCLGAAVAFADWLLSEEQSAAQLFQPEAYTWNTRRGLILALALWFTSLVMAVELRFVVQRAK… |
| A0A5S6R4U7 | 4-170 | SGSFHGVKRDAALISLQILAVQSIFYLCLSMLQALADVLLGVPLSVDQVVNFQIITLRNAESLVRIAVCLVNSVLCAVTLRFIVGRA… |
| A0A7J6PF77 | 8-177 | None |
| A0A1D6NL91 | 2-165 | None |
| A0A7R8H9F2 | 381-534 | None |
| A0A4V3WIY1 | 687-857 | None |
| A0A2G7G845 | 7-164 | None |
| M0ZRN7 | 3-153 | None |
| A0A7J7ILN5 | 20-171 | None |
| H3AMJ9 | 7-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.