DPCstruct | MC9329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661KHM1 | 3-122 | KNCPVCDSQLINTIERPNGRDVTLFSCPRCGEFIVSGTLLATLPNIIQREKDASAKLSHALRTMQLIKRGAELYTNTVNEILKRPLP… |
| A0A7C1NHJ1 | 3-126 | EKTICIICEKDAEKSGVQGKDGYLAECATCGKYFLASPELFEGSYTGMPREKKAMISAYTRERFEHGREPPVLGYPDEDIITEYENK… |
| A0A6N7AMS5 | 1-114 | None |
| A0A7R9NFZ5 | 3-131 | None |
| A0A7D5MV94 | 1-144 | None |
| A0A533BDS6 | 1-139 | None |
| A0A1G3A6H3 | 3-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.