DPCstruct | MC9328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 110 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z7M5Z9 | 1-98 | MILLQSLLNEGEVIADYIVAGSYCVWNCITTPGNTDIAGALEDTLHRILENGGTEDDVQEIMGAHIPNDDPDWMLKDATYLDLGYLL… |
| A0A087D5N9 | 1-133 | MKDADFDISTLLYEGEAIADYTLTGMGTNWGSPVYQCVTQPGSTDIHSALEETLHRIIDARIDTGDADDVLAETMGVVRADSIDAED… |
| A0A173TNH8 | 102-197 | None |
| A0A1Y3S1Q5 | 24-123 | None |
| A0A2N5J6S1 | 506-624 | None |
| A0A415FK79 | 14-155 | None |
| A0A261FL76 | 325-430 | None |
| R6R8B5 | 186-282 | None |
| A0A317UF67 | 6-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.