DPCstruct | MC9326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 4 aa |
| Standard deviation of domain lengths | 4.39 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XMJ8 | 89-191 | HVEFLSSAIQFLDIFSSVEDLNQRVYLQYEMHLLGLDDFIDEMSDCKSDELQARMTAYVNGEMDVAALFEDSQHKARLLEECDQLKI… |
| A0A2J7QS87 | 2-95 | VACMQFVNIVVHSVEDMNFRVHLQYEFTKLGLDDYLEKLRHTESEELQVQISAYLDNVFDVAALMEDSETKTAALEKVAELEDELGH… |
| A0A5J5CDD5 | 106-207 | None |
| A0A3P7LXA9 | 60-153 | None |
| A0A448WAE0 | 2-93 | None |
| A0A4E0S141 | 35-138 | None |
| A0A183M417 | 28-123 | None |
| A0A183P309 | 91-184 | None |
| A0A146M2B5 | 328-423 | None |
| A0A368H367 | 297-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.