DPCstruct | MC9323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 184 |
|---|---|
| Mean domain length (aa) | 194 ± 28 aa |
| Standard deviation of domain lengths | 28.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.37 |
| Pfam Score | 98.92 |
| Assigned Pfam label(s) | CL0123- CL0020- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7QH95 | 167-359 | DSKSDSEEDLSASSEMSDHASPVPDDIHLFFSEVMDSLTRGYDDKLHPDNLILEINSSRYAYNVSVREVNYFVVKALLSLPIQAQSA… |
| D3DN77 | 93-260 | YVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAA… |
| A0A7S1UVI5 | 154-333 | None |
| A0A6J1X5W4 | 369-569 | None |
| A0A7J6Q2X5 | 6-192 | None |
| A0A162P949 | 651-858 | None |
| A0A1S8W719 | 680-897 | None |
| A0A4Y2CDB7 | 377-544 | None |
| A0A3L8E3W7 | 1-142 | None |
| A0A7J6PLV5 | 500-726 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.