DPCstruct | MC9322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 170 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7QF24 | 1-168 | MVAVGNMFNSVKHSSALMNIPSCNYLAHECSGQCVEGYDYCIRHILEDKTAPYRLCGYVYSGNGRRCVMPTLKGDKRESGFCAEHAR… |
| A0A7S4HMN8 | 62-209 | DSDDEPAAKRRRTNAPSRSRRNKDVPSQMCTAARKDGSQCKSKAIVGTQFCWHHAPMDPNSKIAICEYRNTKKNSKRCKLPIPNDEL… |
| A0A0B2VFJ3 | 129-339 | None |
| A0A5E4BV29 | 48-212 | None |
| A0A7R8XE30 | 239-379 | None |
| A0A182FFR1 | 1-235 | None |
| A0A7J8FRJ9 | 17-144 | None |
| A0A0D9WEX1 | 68-242 | None |
| A0A6F9B2F4 | 3-176 | None |
| A0A1I7WUT7 | 33-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.