DPCstruct | MC9320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662LLB7 | 4-102 | QNPILKITTDKMHKFGVRIVNTGDHYGLNDVLVNDGDPLVEFWDHTTFEEGQFVSRYYVKTILDHEYGHDLNLDGGIPEWSIDANSM… |
| A0A2S3QKE2 | 4-113 | LPMLPVYAVRTAQGVPLTVVVWPAAALVRTGAQRHHTNRTGEPVVAFYDRRFRYPPFHPHYGQFIADFGVSTWRTFTASESTARVLD… |
| A0A4Q5C632 | 65-184 | None |
| A0A1I7KL02 | 55-148 | None |
| A0A060UPX6 | 84-192 | None |
| A0A854GCN1 | 1-106 | None |
| A0A1C5QQB1 | 229-354 | None |
| A0A0D7WZ40 | 178-286 | None |
| A0A2N2SS90 | 21-119 | None |
| A0A5M3Q1S1 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.