DPCstruct | MC932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 157 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08560 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8AZX0 | 1-136 | MNFLRLTWHCAKKGIQVGCVLGTAVVAPLTIYRGRRAGKSIDFNRLMLNQTYSILFGTVLSLGMMMGKYWGWENKARSLQDRAYRIG… |
| A0A5S6R4H3 | 164-318 | SFLKNFCGFPCSASELREVPRPKLELGISVTFKSIEAGIVVGSLAIPILQLFTGVRDAESFKRGCYKGAVAGGYFACLAGPLCAVAC… |
| Q22BQ3 | 9-164 | None |
| W7TQG5 | 42-197 | None |
| A0A5A8E020 | 2-190 | None |
| A0A8B6C7F8 | 13-164 | None |
| A0A1I8HST2 | 3-163 | None |
| A0A0B1SR44 | 4-168 | None |
| A0A0V1A9L8 | 3-162 | None |
| A0A067PUI7 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.