DPCstruct | MC9318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 20.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3DUY5 | 13-125 | ATKNYDAYCTKGGALASEKHVCFNANPEFFTSDLRGSNFHGILDDHDHSSNFVMLPIRKTSIIHAAHYTITVDFSLPDSGISRNCAA… |
| A0A1K0H3I5 | 32-179 | HSLTPIAKDKRQPYHVKAQASYILFTAALLGFAKAGWETPTRTLNYNAFCGRRPHPPAGVGYVCLQAKSNAEGFTRESDFRGFLQPG… |
| A0A5C3FJW3 | 2-106 | None |
| A0A081CN30 | 89-240 | None |
| A0A081CN28 | 3-130 | None |
| A0A081CGV7 | 291-420 | None |
| R9PFT6 | 8-114 | None |
| R9PEQ4 | 128-270 | None |
| R9P6G4 | 6-165 | None |
| A0A2N8UIE4 | 31-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.