DPCstruct | MC9317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 119 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.37 |
| Pfam Score | 93.47 |
| Assigned Pfam label(s) | CL0039- CL0105- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J8VXQ2 | 2-100 | DAKALDEAGAFSIVIEGVVETIAIEATRAIACPSIGIGGSAQCDGQVLVTEDMLGMFERVPRFVKKYADMGSVVSEAAAQYAAEVRD… |
| A0A4S9E1K9 | 456-576 | SALKLLDDAIAVQEAGAFAMVVEAVPAEIATLVTKKLRVPTIGIGAGNGCSGQVLVQVDMLGNFPPGRFLPKFVKKYGDVWGEASKA… |
| A0A812NMZ5 | 57-172 | None |
| A0A840H5X3 | 73-191 | None |
| A0A066WBP0 | 185-267 | None |
| A0A1B0C470 | 417-538 | None |
| A0A377CJI8 | 17-134 | None |
| A0A661JB65 | 68-182 | None |
| X7XZP2 | 73-189 | None |
| A0A537TCT7 | 379-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.