DPCstruct | MC9315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5J1Z3 | 3-86 | PELELVIVRDPDGGTTVEAFLGGKPILATEYVIDAGSGGDWEGWKETRDENLAAASPKVRTALLSAYDDPPGGNYVRDRGDEPW |
| A1UQT1 | 1-90 | MEMVLVQDPDGGTETTVFLDGAVLQGVDEYVVDAGRGHTYSDWIEARDDALEGASPAAAELLRTSYDYPPGYKYIDGAPDGWPFEDG… |
| A0A366DMI9 | 105-179 | None |
| A0A1F2PPQ7 | 122-193 | None |
| A0A2A3F521 | 100-199 | None |
| A0A1S6GKX1 | 7-91 | None |
| R4V095 | 13-100 | None |
| A0A5C7YR02 | 1-68 | None |
| A0A3N4SH21 | 86-159 | None |
| A0A829HNV5 | 116-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.