DPCstruct | MC9312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A319CJS0 | 1-96 | MHHEFKQGPIKITVGHEYGIGYFISVQDERLVVKGEELPYSSLDEACCNVDSSGAGIYLAARTGNEGCGTQVNIEAMRRLWELYGVK… |
| A0A395GM76 | 1-93 | MVRHEHDEGHWAVAVGHDQASGYFISVYDRRLEIEDSTGDDFERLAYSIAPDGTGCYLNAYTGSFGMGQKVSLKTMERLWRMYGAPK… |
| A0A197JIK4 | 1-100 | None |
| Q4WGW7 | 45-160 | None |
| A1DCZ2 | 21-118 | None |
| A0A1Y2GRW9 | 1-112 | None |
| A0A0C3AX77 | 1-93 | None |
| A0A5N6TTJ5 | 1-104 | None |
| A0A6A6GS15 | 47-140 | None |
| A0A814RVF9 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.