DPCstruct | MC931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 310 ± 28 aa |
| Standard deviation of domain lengths | 28.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9Z9Y6 | 124-427 | MTSPNVVLMLDITTVMASVLAQGYKVAVHCHAGYGRTGLAIACTLVFQHGISAQEAIQIVRRGRPGSIQTHGQVAFVGRFHDHLRQS… |
| A0A5S6R1C4 | 7-355 | LFSSSFQLFVKNFLRRFPRKLPAGCRSFGRRLRTTIAVHCHAGLGRTGMTICCFIIWTKGWTPQEALEYVRKRRPGSVQTQSQQAVV… |
| A0A1Y2HSH7 | 185-485 | None |
| A0A815Y0L9 | 1-346 | None |
| A0A2R6WYV7 | 210-529 | None |
| A0A2W1BEN3 | 6-293 | None |
| A0A177WL81 | 1-269 | None |
| A0A067BIJ9 | 15-329 | None |
| A0A1I8IV12 | 719-1031 | None |
| A0A1I8G2T9 | 38-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.