DPCstruct | MC9308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1ZHW3 | 1-98 | MNIWQHCLLSQRKFGGQPQDYEQIHSFIDSSKYFYHHVKHRLLLHNMFGVELATELIGNLITNSDQRQVLVRDIAVEHCREDLNGRT… |
| A0A7Y9Z610 | 1-101 | MAHPLHHAESSAGKFGGVPSDYQSIHDWFDASKEHLALFTHRAMRHHAQGLFEAERVFGLTLTNSAGRDIPVRWIGELDLSRFRAAP… |
| A0A420G994 | 55-169 | None |
| A0A4P9WST2 | 142-265 | None |
| A0A3S0F5D3 | 1-100 | None |
| A0A849Y3D6 | 1-87 | None |
| A0A7C5REP4 | 43-159 | None |
| A0A5C7UFC0 | 1-115 | None |
| A0A7Z8Y369 | 2-88 | None |
| A0A2D6BEC2 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.