DPCstruct | MC9307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9GTB6 | 14-93 | FRPVKHDIAPYKQVMVNWPRDNQSRLGLGELVFEDEVFGPESLEFDNLGRGPYTGLADGRVVRWMGENVGWETFALVTRN |
| W9T1T0 | 12-107 | AFAVLFSALFAANHVFDFASLSTKDPKSLSDHDHDHHDFGHFEFLPIVGALSPESYAFDSLGDGPYTGESDGRIIKWQEDQQRWIDF… |
| A0A7J9LHG1 | 2-83 | None |
| A0A368PGA3 | 4-88 | None |
| A0A6A6LFN3 | 4-109 | None |
| A0A6J5W0M8 | 22-122 | None |
| A0A2G2WR75 | 2-79 | None |
| A0A2K1IBC6 | 1-81 | None |
| A0A2G3CD92 | 2-97 | None |
| A0A5A7NZ07 | 206-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.