DPCstruct | MC9304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G7LQI3 | 96-152 | MSRLDPEGPWLERGARALDNPRTSTGEESLERLFAILDALREGGRQSEAFSILKNQI |
| W9SCT1 | 1-60 | MSGLDPEGDWLGRGARALENSRTSTGEESLEKLYTLREDLERRGVNSEAFSLFQERVPLR |
| A0A6A1W8I2 | 1-72 | None |
| A0A699IS65 | 170-239 | None |
| A0A3S3N320 | 220-269 | None |
| A0A445G8M8 | 343-397 | None |
| A0A7J9I5N3 | 115-168 | None |
| E6ZDW7 | 31-97 | None |
| A0A6A1ULL2 | 1-70 | None |
| A0A023VX57 | 47-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.