DPCstruct | MC9303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068VLY7 | 3-87 | DKETEFLCKLTANHLFLAQFERLRATLRSLRVRSPELARSILQTIVAKGGRFDSVLWSHHSCPSPSLLAFLSTLELLQFNEPVLG |
| W9SCI7 | 1-93 | MDNEPEILARLAANHLFLAQFEPLRAIIHALRAKDPELALTVLQTIVAHSGQFENVLWSSSCASPSLLTYLVTLELLQFDNASSVWS… |
| A0A0K9R2M3 | 12-98 | None |
| A0A453EZX3 | 5-91 | None |
| A0A453EZU5 | 5-91 | None |
| A0A444BX82 | 1-96 | None |
| A0A438KF21 | 1-91 | None |
| A0A2P2L9N4 | 1-85 | None |
| A0A2G5C3Y0 | 1-96 | None |
| A0A0K9NXV0 | 11-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.