DPCstruct | MC9301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 315 |
|---|---|
| Mean domain length (aa) | 139 ± 22 aa |
| Standard deviation of domain lengths | 21.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.39 |
| Pfam Score | 83.00 |
| Assigned Pfam label(s) | PF07833- CL0190- PF11741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662CRR9 | 6-151 | TWLAIGWILFVSPILAKTPPLHQVEVYNVRSYTHPSYTRIVIDVGRLREYIFNELKSPDRVYIDVFQAKLNPILHGKTIYVNNPYIH… |
| A0A847BRC3 | 2-82 | RMEIETKDDLIRHFMVVDPYKVVLDFENDTSFYTKEIDIEYGAFKSVTLGNHKGYYRSAILLDGHYIYEINKIDGGYEVIL |
| A0A7Y5ICZ9 | 4-168 | None |
| A0A2G1YT28 | 16-168 | None |
| A0A0X2NJ82 | 51-180 | None |
| D3UGX1 | 16-153 | None |
| A0A0K2XHG6 | 97-192 | None |
| A0A124FRK0 | 15-153 | None |
| A0A075HLP9 | 231-353 | None |
| A0A1Y6B5G5 | 223-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.