DPCstruct | MC930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 225 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2LWW2 | 2-206 | GEKAKSFLGKSISALIKKLEALKSWVLNKRALEESDRQAIASEIDKDIAWLNDKALKASTATPEEIKEQARTIRQYWKKHRIWMKKI… |
| A0A1F7YRM7 | 43-272 | VFTLDTYNDAHSEYVLARAQFLQAGTLVSQTKARESTAAMLIARDNVVITYLTALRLRLAEAENVSDGTKQGLYNRMDSEIDWYQNH… |
| A0A2D6K5A3 | 158-396 | None |
| A0A662QQM9 | 232-477 | None |
| A0A358QLE3 | 41-272 | None |
| A0A1D2UYW1 | 88-300 | None |
| A0A0B3AMA4 | 284-520 | None |
| A0A0E3S277 | 6-190 | None |
| A0A662RBZ7 | 41-285 | None |
| A0A101DC16 | 9-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.