DPCstruct | MC93
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 229 ± 36 aa |
| Standard deviation of domain lengths | 35.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2EUF3 | 4-219 | APAKRVALWGAEGGFVTATMNVLRPPRVVVYSDGVVIADASKQLKLTENEVSKIVASMRTYLTGQPPTAQPRPDAPTVSDVPTTVLG… |
| A0A7Y5BNK5 | 37-238 | SPDALIISVVPMYQEIDYNYIPDFRVWGDGRIVWVEHLAIGGRKVYEGYLSHDEMEQIIVDFIEADFFKGYELFNNKDYAFDHLDID… |
| A0A2N2P828 | 40-314 | None |
| A0A7Y5MQG8 | 2-203 | None |
| A0A355EUT5 | 2-213 | None |
| A0A495VTM5 | 21-239 | None |
| A0A7Y4JN80 | 8-207 | None |
| A0A4Q3JSH4 | 1-243 | None |
| A0A4Q4ZB22 | 3-209 | None |
| A0A838RQ73 | 2-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.