DPCstruct | MC9298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 165 ± 16 aa |
| Standard deviation of domain lengths | 16.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218VN44 | 89-245 | ATNYAQGEIDSLQAAESFMQRTRFPSHALILGRPDEPWFQKGIRDRDWLLDKIATLLTQHPAVWLETDMRAHLNPLRQQMIREAGEQ… |
| A0A0F3II14 | 13-191 | LYDYKNNIEIVGTEQRPFKNIQKLITTKEELIPLVKDIDFPKNNLIIRPNNEDDQFIKKDFLSVDELFNEFDLLLEKSINGVVFVEN… |
| A0A388Q3R0 | 51-211 | None |
| U4QS09 | 182-358 | None |
| A0A0J6WMU7 | 100-263 | None |
| G6FTP0 | 563-743 | None |
| A0A349LMA2 | 11-134 | None |
| A0A1W9K5G7 | 2-182 | None |
| A0A3C1NUC2 | 5-167 | None |
| A0A090D0J7 | 877-1043 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.