DPCstruct | MC9297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J0VCA5 | 1-99 | MLEIVLSPVKAQQFTVTLGAQVCTIRLNQRTTGMYIDITVNGEPCLYGVLCLNNNRIVRYGYLPFQGDLFFSDTEGNHDPDWRGLGS… |
| A0A520B9M3 | 2-105 | AVIKLPLDQALPWYNFSIVLSGTRYGIEVRYNTRDARWRLSLYDAGGAAILLGLPMLTGRSITDQYRTYPVPPGVLAVIDTTGNDTP… |
| A0A7J0BXT4 | 1-102 | None |
| A0A1Y4D1N0 | 2-109 | None |
| A0A8A5CZJ6 | 2-113 | None |
| A0A7Y0BP60 | 227-322 | None |
| A0A0R2CVI2 | 1-100 | None |
| A0A377FAK4 | 55-146 | None |
| V6IXH0 | 2-120 | None |
| A0A401FPZ7 | 5-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.