DPCstruct | MC9292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 174 ± 36 aa |
| Standard deviation of domain lengths | 36.35 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832HQC8 | 363-532 | KTAGISEEFKKRCGPQFVFEGPCVIFESQEEACEGILAGKVKAGDVVIIRNEGPRGGPGMQEMLSPTSYIVGMGLGDKVALITDGRF… |
| A0A2E0H4D6 | 2-148 | FSDYNDMATRIDDDALEVTKNSVLVLKNAGPQGGPGMPEWGMLPIPKKLLKQGVRDMVRISDARMSGTSYGTCVLHVSPESFVGGPL… |
| H0ESC2 | 295-465 | None |
| A0A2U1MVY4 | 693-979 | None |
| A0A3D5DRB6 | 58-230 | None |
| A0A7S4E837 | 422-618 | None |
| A0A066VG21 | 357-520 | None |
| A0A3D8IVE9 | 314-499 | None |
| R6HIP7 | 22-204 | None |
| A0A0M9F6J5 | 414-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.