DPCstruct | MC929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2H478 | 4-87 | DPKEKVLFNLLAHGYINKRHTTIDNACKSFPKGEKNKAKHAINELILEGIILVKKTHHGADIYINPKMIRDILEMPGIKALLEE |
| A0A7D5R9N8 | 6-82 | RAVHVLNKMYHYGYVGGRHTSIETIKKSFASHEKGMVDKAIKNLVKAGLIICHPTSYGHQYSLNPNRIKEIENIIQS |
| A0A5B2Z2G2 | 1-77 | None |
| A0A2V6E713 | 1-95 | None |
| D1Z0C9 | 8-89 | None |
| A0A7V9Q309 | 109-183 | None |
| A0A2D6TYT8 | 39-122 | None |
| A0A2H9QB06 | 7-86 | None |
| A0A843CLZ4 | 5-69 | None |
| A0A1Q7KX46 | 38-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.