DPCstruct | MC9281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 237 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822GKY1 | 229-453 | GKRVLTAKEKKSQLDDKTRLTELFAVSLPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLEALLRQIRSIVEKHTDTDVLE… |
| A0A2U1L022 | 10-225 | PAIDHGKPNYTKAQREMIESNKKNITVCMIKNYPQLMRKYMADKTKVPSLVEIIVHMDLELYSLKSQDQKFKTVLQLIKETFFKHGD… |
| A0A7J5XNW5 | 523-765 | None |
| A0A4D9BA71 | 159-423 | None |
| A0A0B1SNE5 | 222-472 | None |
| A0A2U1MMV9 | 57-292 | None |
| A0A2H2JK42 | 2-192 | None |
| G7J1X1 | 108-324 | None |
| L0PIH1 | 253-516 | None |
| A0A2V3IWQ0 | 3-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.