DPCstruct | MC9280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 39.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7MLD0 | 118-248 | MGTDTSTGSSNFFEPAFLSDDPMYIIQPWCLSDSTFYLPIQLTSARTQEVRCVQGSHLWRNSSSEVNDELFKGYQLGNREGKVNEIV… |
| A0A2U1KZZ8 | 80-191 | GSDSSTATSGFLEPALYLHGPVYYVQSQCGANFTNSMVSIAALNVEKEIKCVQGLNVWRNSSSDITKELYSGYRKGNAEKKINAIPV… |
| A0A565BSZ9 | 23-171 | None |
| A0A453SBN6 | 20-160 | None |
| A0A565B0H8 | 2-111 | None |
| A0A816XYN1 | 34-155 | None |
| A0A6S7M3X7 | 8-120 | None |
| A0A452ZL79 | 17-154 | None |
| A0A452ZL54 | 2-139 | None |
| A0A3L6QJE0 | 20-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.